PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06266.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 777aa    MW: 83270.1 Da    PI: 10.2126
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06266.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-14511558148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g W++eEd++l d + ++G g+W++ +++ g+ R +k+c++rw +yl
  Zmw_sc06266.1.g00030.1.am.mk 511 KGLWSPEEDQKLRDFIVRYGHGCWSALPAKAGLQRNGKSCRLRWINYL 558
                                   678*******************************************97 PP

2Myb_DNA-binding52.11.5e-16565609248
                                   SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   g ++ eE+e   +++++lG++ W+ Iar+++ gRt++++k++w++yl
  Zmw_sc06266.1.g00030.1.am.mk 565 GMFSREEEETVMNLHAKLGNK-WSHIARHLP-GRTDNEVKNYWNSYL 609
                                   56999****************.*********.*************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-20503561IPR009057Homeodomain-like
PROSITE profilePS5129414.645506558IPR017930Myb domain
SuperFamilySSF466891.36E-27509605IPR009057Homeodomain-like
SMARTSM007174.0E-11510560IPR001005SANT/Myb domain
PfamPF002492.1E-12511558IPR001005SANT/Myb domain
CDDcd001679.07E-10514558No hitNo description
PROSITE profilePS5129425.468559613IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.4E-24562612IPR009057Homeodomain-like
SMARTSM007173.5E-14563611IPR001005SANT/Myb domain
PfamPF002497.4E-15565609IPR001005SANT/Myb domain
CDDcd001671.21E-11567609No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 777 aa     Download sequence    Send to blast
MAPWEFRRAG LDPRGARVRI FSGSNNSASL GGRKKRTKTE RSNGWALSVL FSAGKYSLAL  60
FFVDDDADSG LPSLLPIPSA AVQPSPQLLT PRRRQPGAPG AADRRRGAGV ARAEAGTLVK  120
LGEAAAVQAL GRLGSRGSCD AGAKSFAFDY SIPHPAIGVT PTIHAGANLP CTRNRNGRAK  180
RERGGKPTAA RLTAGHLWCS SGCSSRTAAA AARVALCSGK ASSRRQHAHV AIRPPAPNGN  240
RAVPYSMAPV FFVAEPTHWQ RALLSVPYVV MRVETKHPKQ VRAGSHRDVK PGGSRLPDHD  300
PKFIGPDAMH SRRMCKLSSD SCGDDDPGRP EAEADAADPP LPLTPFWRFG AGQRLGSGPG  360
SPCSCRSPAR ETEPNQRGGD GARQRRNAVF AVRKSEIFLS FSATGGGLQD TEMFASSHQT  420
GKIIRRSLIL KMPMRRRVAT ATAPWLRKQA VDIYPIKPSA QPALAVLTPT QTDTTVQAHP  480
QSLPFSSATP RSQSNHHPLA VPCAPKVQCR KGLWSPEEDQ KLRDFIVRYG HGCWSALPAK  540
AGLQRNGKSC RLRWINYLRP GLKHGMFSRE EEETVMNLHA KLGNKWSHIA RHLPGRTDNE  600
VKNYWNSYLK KRVEGGQASK CAADSDVSGS TNTSETSQER LNRPASSESS SPVESSSADD  660
SSCLTVTEPV APAAAAALRP HAPVLPRVMF ADWLDMDYGT NLMAPGLDPA GVFDVMNGRS  720
PTQGSVQVDG PCGAVDSLHG LDDGGVCWGF DAAADQMDVQ GAGFCDLLSM SEFLGIN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-265116147109B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP170737109